PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000767G0040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family TCP
Protein Properties Length: 370aa    MW: 38503.7 Da    PI: 9.5921
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000767G0040genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP109.84e-34501591112
              TCP   1 aagkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksa 94 
                      a+g+kdrhsk++T++g RdRRvRls+++a++f+dLqd+LG+d++sk+ieWL+++a   i++l+++  ++a ++ a++++ +a++ + ++++  +
  PH01000767G0040  50 ATGGKDRHSKVYTAKGIRDRRVRLSVPTAIQFYDLQDRLGYDQPSKAIEWLINAASVNIDKLPSL--DPAAFF-AVTEQAEADAGKVKHQQVCK 140
                      5899*************************************************************..444233.22333333322222222222 PP

              TCP  95 a.kskksqksaasalnlak 112
                        +s+ s++s+ s l+ ++
  PH01000767G0040 141 SgCSSTSETSKGSELSRSR 159
                      2233333333332222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.4E-3352159IPR005333Transcription factor, TCP
PROSITE profilePS5136931.22153111IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
GO:1903508Biological Processpositive regulation of nucleic acid-templated transcription
GO:2000306Biological Processpositive regulation of photomorphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MEAVGDAAGA GEGEGAPGRT QGRAKRGRGV NDGLEQQGLG AASRIYRVRA TGGKDRHSKV  60
YTAKGIRDRR VRLSVPTAIQ FYDLQDRLGY DQPSKAIEWL INAASVNIDK LPSLDPAAFF  120
AVTEQAEADA GKVKHQQVCK SGCSSTSETS KGSELSRSRS DSRVGGSRDK EVTVVSTSAQ  180
AASFTELLTG VGSAGAIGAA EQRRSWQPPS VPAVAADCVG IAHPGKGAQG VSTYGFSSST  240
ASSFGNVPPI GMAPAQPFNF ASSAEMMHFS LVQDAFAAAS APAGDYNLNF SMSSGFLVGN  300
RGTLQSNSQS HFSGHHQHLQ RLDGPSPPFL FGHAAAAAHP ALENQLTASA ALQLRDGFRH  360
SGMKEKSKN*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00006PBMTransfer from 493022Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008644443.11e-160PREDICTED: transcription factor PCF6-like
SwissprotQ10CE81e-117PCF6_ORYSJ; Transcription factor PCF6
TrEMBLA0A096RD661e-160A0A096RD66_MAIZE; Uncharacterized protein
STRINGGRMZM2G089361_P011e-160(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30943271
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18390.22e-39TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 2